Anti-SUR1/ABCC8 Antibody Picoband™

SUR1 antibody

Boster Bio Anti-SUR1/ABCC8 Antibody Picoband™ catalog # A00895-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Product Info Summary

SKU: A00895-1
Size: 100 μg/vial
Reactive Species: Human, Mouse, Rat
Host: Rabbit
Application: Flow Cytometry, IHC, ICC, WB

Product Name

Anti-SUR1/ABCC8 Antibody Picoband™

View all SUR1 Antibodies

SKU/Catalog Number

A00895-1

Size

100 μg/vial

Form

Lyophilized

Description

Boster Bio Anti-SUR1/ABCC8 Antibody Picoband™ catalog # A00895-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Storage & Handling

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Cite This Product

Anti-SUR1/ABCC8 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00895-1)

Host

Rabbit

Contents

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Clonality

Polyclonal

Isotype

Rabbit IgG

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human SUR1, which shares 97.7% amino acid (aa) sequence identity with both mouse and rat SUR1.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

A00895-1 is reactive to ABCC8 in Human, Mouse, Rat

Applications

A00895-1 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee

Observed Molecular Weight

177 kDa

Calculated molecular weight

176.992kDa

Background of SUR1

ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Reconsitution

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For ABCC8 (Source: Uniprot.org, NCBI)

Gene Name

ABCC8

Full Name

ATP-binding cassette sub-family C member 8

Weight

176.992kDa

Superfamily

ABC transporter superfamily

Alternative Names

ABC36; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; HHF1Sulfonylurea receptor 1; HI; PHHIHRINS; sulfonylurea receptor (hyperinsulinemia); SUR1MRP8; SURATP-binding cassette transporter sub-family C member 8; TNDM2ATP-binding cassette sub-family C member 8 ABCC8 ABC36, HHF1, HI, HRINS, MRP8, PHHI, PNDM3, SUR, SUR1, SUR1delta2, TNDM2 ATP binding cassette subfamily C member 8 ATP-binding cassette sub-family C member 8|ATP-binding cassette transporter sub-family C member 8|ATP-binding cassette, sub-family C (CFTR/MRP), member 8|sulfonylurea receptor (hyperinsulinemia)|sulfonylurea receptor 1

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on ABCC8, check out the ABCC8 Infographic

ABCC8 infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for ABCC8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for A00895-1

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-SUR1/ABCC8 Antibody Picoband™?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-SUR1/ABCC8 Antibody Picoband™

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

1 Customer Q&As for Anti-SUR1/ABCC8 Antibody Picoband™

Question

Is the epitope on the extracellular side of the membrane or intracellular?

Verified customer

Asked: 2020-09-25

Answer

The immunogen sequence of A00895-1 is 906-948aa TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA, which is located in cytoplasmic region. https://www.uniprot.org/uniprot/Q09428#sequences

Boster Scientific Support

Answered: 2020-09-26

Order DetailsPrice
A00895-1

100μg

$370
A00895-1-10ug

10μg sample (liquid)

$99
A00895-1-Biotin

100 μg Biotin conjugated

$570
A00895-1-Cy3

100 μg Cy3 conjugated

$570
A00895-1-Dylight488

100 μg Dylight488 conjugated

$570
A00895-1-Dylight550

100 μg Dylight550 conjugated

$570
A00895-1-Dylight594

100 μg Dylight594 conjugated

$570
A00895-1-FITC

100 μg FITC conjugated

$570
A00895-1-HRP

100 μg HRP conjugated

$570
A00895-1-APC

100 μg APC conjugated

$670
A00895-1-PE

100 μg PE conjugated

$670
A00895-1-carrier-free

Carrier Free

$370

More conjugates/formats

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
A00895-1
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$370.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.