Product Info Summary
SKU: | A00895-1 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SUR1/ABCC8 Antibody Picoband™
SKU/Catalog Number
A00895-1
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SUR1/ABCC8 Antibody Picoband™ catalog # A00895-1. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SUR1/ABCC8 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # A00895-1)
Host
Rabbit
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human SUR1, which shares 97.7% amino acid (aa) sequence identity with both mouse and rat SUR1.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
A00895-1 is reactive to ABCC8 in Human, Mouse, Rat
Applications
A00895-1 is guaranteed for Flow Cytometry, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
177 kDa
Calculated molecular weight
176.992kDa
Background of SUR1
ATP-binding cassette transporter sub-family C member 8 is a protein that in humans is encoded by the ABCC8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a modulator of ATP-sensitive potassium channels and insulin release. Mutations and deficiencies in this protein have been observed in patients with hyperinsulinemic hypoglycemia of infancy, an autosomal recessive disorder of unregulated and high insulin secretion. Mutations have also been associated with non-insulin-dependent diabetes mellitus type II, an autosomal dominant disease of defective insulin secretion. Alternatively spliced transcript variants have been found for this gene.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml
Immunohistochemistry (Frozen Section), 0.5-1μg/ml
Immunocytochemistry, 0.5-1μg/ml
Flow Cytometry, 1-3μg/1x106 cells
Validation Images & Assay Conditions
Click image to see more details
Figure 1. Western blot analysis of SUR1 using anti-SUR1 antibody (A00895-1).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: human placenta tissue lysates,
Lane 2: rat brain tissue lysates,
Lane 3: mouse brain tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-SUR1 antigen affinity purified polyclonal antibody (Catalog # A00895-1) at 0.5 μg/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for SUR1 at approximately 177KD. The expected band size for SUR1 is at 177KD.
Click image to see more details
Figure 2. Flow Cytometry analysis of A431 cells using anti-ABCC8 antibody (A00895-1).
Overlay histogram showing A431 cells stained with A00895-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-ABCC8 Antibody (A00895-1,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For ABCC8 (Source: Uniprot.org, NCBI)
Gene Name
ABCC8
Full Name
ATP-binding cassette sub-family C member 8
Weight
176.992kDa
Superfamily
ABC transporter superfamily
Alternative Names
ABC36; ATP-binding cassette, sub-family C (CFTR/MRP), member 8; HHF1Sulfonylurea receptor 1; HI; PHHIHRINS; sulfonylurea receptor (hyperinsulinemia); SUR1MRP8; SURATP-binding cassette transporter sub-family C member 8; TNDM2ATP-binding cassette sub-family C member 8 ABCC8 ABC36, HHF1, HI, HRINS, MRP8, PHHI, PNDM3, SUR, SUR1, SUR1delta2, TNDM2 ATP binding cassette subfamily C member 8 ATP-binding cassette sub-family C member 8|ATP-binding cassette transporter sub-family C member 8|ATP-binding cassette, sub-family C (CFTR/MRP), member 8|sulfonylurea receptor (hyperinsulinemia)|sulfonylurea receptor 1
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on ABCC8, check out the ABCC8 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for ABCC8: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SUR1/ABCC8 Antibody Picoband™ (A00895-1)
Hello CJ!
No publications found for A00895-1
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SUR1/ABCC8 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-SUR1/ABCC8 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
1 Customer Q&As for Anti-SUR1/ABCC8 Antibody Picoband™
Question
Is the epitope on the extracellular side of the membrane or intracellular?
Verified customer
Asked: 2020-09-25
Answer
The immunogen sequence of A00895-1 is 906-948aa TIQREGTLKDFQ RSECQLFEHWKTLMNRQDQELEKETVTERKA, which is located in cytoplasmic region. https://www.uniprot.org/uniprot/Q09428#sequences
Boster Scientific Support
Answered: 2020-09-26